DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and ACXD

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster


Alignment Length:153 Identity:35/153 - (22%)
Similarity:62/153 - (40%) Gaps:45/153 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 IIKQC--AQVIFGPVCDYSLAAVSRIT-KYFNSQGTP------------LISVGGSTYDFEQK-- 153
            |||.|  |.::.|    |::..||... .|.||..|.            :|...|..:..|::  
  Fly   766 IIKSCFSALIMIG----YAVLVVSEFNFIYANSPSTNVNFNAKYSHILLMIITFGIFHLMERQTE 826

  Fly   154 ---KTDCNDEFYMLLR--TGMLSFETISELTINVMKRH--------NWSHSIFYYERDGQRSVAG 205
               |.|.|.:..::.:  ..:::.:||..|..|::..|        ...:.::|.|.|   :||.
  Fly   827 FIAKVDYNWKRQLIKKQEDALITNDTIKVLLTNILPTHVADFYLSNQLQNELYYEEYD---NVAV 888

  Fly   206 MHTCFLMMKS-----LGKQMRNE 223
            |   |..:|:     :|.::.||
  Fly   889 M---FASIKNFDTDKIGLRVLNE 908

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 35/153 (23%)
ACXDNP_620469.2 AC_N <42..284 CDD:292831
CYCc 254..476 CDD:214485
Nucleotidyl_cyc_III 321..503 CDD:299850
CYCc 856..1117 CDD:214485 14/59 (24%)
Nucleotidyl_cyc_III 878..1142 CDD:299850 11/37 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.