DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and ACXC

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster


Alignment Length:194 Identity:35/194 - (18%)
Similarity:72/194 - (37%) Gaps:58/194 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SLIPSHIDFEWLAHDT--KCDASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRITKYFNSQGT 138
            |.:..|| ||.:.|..  :....||::.:...:|   :.::..  ||..:..:|    |..|:  
  Fly   660 SCMAFHI-FEKIQHSVSLRITVYLGILFSYYAVI---SLIMLN--CDRDMYELS----YIESK-- 712

  Fly   139 PLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSF----------------------ETISELTIN 181
                    .|.:|..:..|   |:..:.|.|:|.                      ||::.|.|.
  Fly   713 --------IYHYEMDRDTC---FHPWVFTNMISLILGISYTFARIPFGLKIVISCCETLAYLLIV 766

  Fly   182 VMK-----RHNWSHSIFYYERDGQRSVAG-MHTCFLMMKSLGKQMRNENMTFAQFPLEPNLTNR 239
            ..:     :|:.:.:.|.     :..:|. :..|.:::....|:.::|..|...:.|..:|.|:
  Fly   767 FFQFAFIFQHSATTTPFM-----KAELAHCLRVCMMLLTMYAKERQSEFNTKMNYKLNVDLQNK 825

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 35/194 (18%)
ACXCNP_609593.1 AC_N <33..285 CDD:292831
CYCc 293..468 CDD:214485
Nucleotidyl_cyc_III 307..466 CDD:299850
CYCc 833..1060 CDD:214485
Nucleotidyl_cyc_III 861..1085 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.