Sequence 1: | NP_650507.1 | Gene: | CG14877 / 41929 | FlyBaseID: | FBgn0038380 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097148.1 | Gene: | Gyc32E / 34553 | FlyBaseID: | FBgn0010197 | Length: | 1191 | Species: | Drosophila melanogaster |
Alignment Length: | 202 | Identity: | 41/202 - (20%) |
---|---|---|---|
Similarity: | 72/202 - (35%) | Gaps: | 51/202 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 LLVLLLVGLVFGPKDCVATC-REEPARDCEAICDANGRNCTIRALVLLPDDNMYQASL------- 58
Fly 59 ------PRVLPILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGP 117
Fly 118 VCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINV 182
Fly 183 MKRHNWS 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14877 | NP_650507.1 | Periplasmic_Binding_Protein_Type_1 | 46..>241 | CDD:299141 | 30/157 (19%) |
Gyc32E | NP_001097148.1 | PBP1_Speract_GC_like | 44..448 | CDD:107365 | 31/161 (19%) |
ANF_receptor | 59..427 | CDD:279440 | 29/145 (20%) | ||
PHA02988 | 534..826 | CDD:165291 | |||
PK_GC-A_B | 550..832 | CDD:270944 | |||
HNOBA | <847..886 | CDD:285003 | |||
CYCc | 865..1057 | CDD:214485 | |||
Guanylate_cyc | 892..1076 | CDD:278633 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |