DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and CG32305

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster


Alignment Length:253 Identity:52/253 - (20%)
Similarity:90/253 - (35%) Gaps:83/253 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PKDCVATCREEPARDCEAICDANGRNCT-----IRALVLLPDDNM--------------YQASLP 59
            |:..:.|.:||   .|..|.|.: :|.|     :|.|.|.|..|:              .....|
  Fly   257 PRKMIRTLQEE---ICSRIEDQD-KNFTPSKAGLRKLFLEPYPNVSILVADMVNYTHLTTTLEAP 317

  Fly    60 RVLPIL-------KVAEQQIRSKSL------------IPSHIDFEWLAHDTKC-DASLGVIKAMD 104
            :::.||       .:|..:.|:..:            ||::..    ||.:.| |.:|.:|....
  Fly   318 QLVEILHDLFVNFDLAANRNRAMRIKFLGDSYNCVAGIPNYFP----AHASCCVDQALEMIHITQ 378

  Fly   105 GIIKQCAQVIFGPVCDYSLAAVSRITKYFNSQGTPLISVGGST---YDFEQKKTDCNDEFYMLLR 166
            |:..:       ...|.:|    ||..:   .|.....:.|.|   :|...|..|..:.   |..
  Fly   379 GVSSR-------RELDINL----RIGVH---SGEVFAGIIGHTKWQFDIWSKDVDITNR---LES 426

  Fly   167 TGMLSFETISELTINVMKRHNWSHSIFYYERDGQRSV--------AGMHTCFLMMKSL 216
            :|:.....:|:.|::::..|       |..|:|..:.        ||:.| ||:...|
  Fly   427 SGLPGLVHVSQRTLSMLDEH-------YIFREGTEAAKNDPILQQAGIRT-FLVSNRL 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 41/216 (19%)
CG32305NP_728725.2 CYCc 251..449 CDD:214485 44/223 (20%)
Nucleotidyl_cyc_III 292..445 CDD:299850 30/173 (17%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.