DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and GUCY2D

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_000171.1 Gene:GUCY2D / 3000 HGNCID:4689 Length:1103 Species:Homo sapiens


Alignment Length:165 Identity:31/165 - (18%)
Similarity:56/165 - (33%) Gaps:66/165 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 IIKQC--AQVIFGPVCDYS---------------LAAVSRITKYFNSQGTPLISVGGSTYDFEQK 153
            ::|||  .|....|..|::               :.::.|:.:.::|....||.......:.|::
Human   783 LMKQCWAEQPELRPSMDHTFDLFKNINKGRKTNIIDSMLRMLEQYSSNLEDLIRERTEELELEKQ 847

  Fly   154 KTD--------------------CNDEFY---MLLRTGMLSFETISELT--INVMKRHN------ 187
            |||                    ...|::   .|..:.::.|.|||.::  |.|:...|      
Human   848 KTDRLLTQMLPPSVAEALKTGTPVEPEYFEQVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLF 912

  Fly   188 ----WSHSIFYYE--------------RDGQRSVA 204
                .||.::..|              |:|||..|
Human   913 DAIIGSHDVYKVETIGDAYMVASGLPQRNGQRHAA 947

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 31/165 (19%)
GUCY2DNP_000171.1 PBP1_sensory_GC_DEF-like 55..431 CDD:380594
PK_GC-2D 536..811 CDD:270945 6/27 (22%)
HNOBA <820..865 CDD:369471 8/44 (18%)
CYCc 846..1036 CDD:214485 20/102 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1065..1103
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.