DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and GUCY2F

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001513.2 Gene:GUCY2F / 2986 HGNCID:4691 Length:1108 Species:Homo sapiens


Alignment Length:150 Identity:34/150 - (22%)
Similarity:56/150 - (37%) Gaps:34/150 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DNMYQASLPRVLPILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIK--QCAQV 113
            |:::..:||.|...|.: |:..|..|...|: .||::..:..|..|    :|:...|.  |.|..
Human    64 DSLFSKALPEVAARLAI-ERINRDPSFDLSY-SFEYVILNEDCQTS----RALSSFISHHQMASG 122

  Fly   114 IFGPVCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETIS-- 176
            ..||.......|.|.:.   ||....:.|.....|:.:.|                :|:.|.|  
Human   123 FIGPTNPGYCEAASLLG---NSWDKGIFSWACVNYELDNK----------------ISYPTFSRT 168

  Fly   177 -----ELTINVMKRHNWSHS 191
                 .:.:.|||...|:|:
Human   169 LPSPIRVLVTVMKYFQWAHA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 34/149 (23%)
GUCY2FNP_001513.2 PBP1_sensory_GC_DEF_like 54..435 CDD:107366 34/149 (23%)
ANF_receptor 75..412 CDD:279440 30/138 (22%)
PKc_like 545..815 CDD:304357
HNOBA <824..869 CDD:285003
CYCc 848..1040 CDD:214485
Guanylate_cyc 875..1062 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.