DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and GUCY2C

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_004954.2 Gene:GUCY2C / 2984 HGNCID:4688 Length:1073 Species:Homo sapiens


Alignment Length:102 Identity:28/102 - (27%)
Similarity:44/102 - (43%) Gaps:15/102 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 VIFGPVCDYSLAAVSRITKYFNSQ-GTPLISVG--GSTYDFEQKKT----DCNDEFYMLL---RT 167
            |:.||.|.|     |....|.::: ..|:||.|  |.:.|:::..|    ......|.|:   :|
Human   118 VLIGPSCTY-----STFQMYLDTELSYPMISAGSFGLSCDYKETLTRLMSPARKLMYFLVNFWKT 177

  Fly   168 GMLSFETISELTINVMKRHNWSHSIFYYERDGQRSVA 204
            ..|.|:|.|..|..|.|....:...|:|....:.||:
Human   178 NDLPFKTYSWSTSYVYKNGTETEDCFWYLNALEASVS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 28/102 (27%)
GUCY2CNP_004954.2 PBP1_GC_C_enterotoxin_receptor 35..415 CDD:107364 28/102 (27%)
PK_GC-C 480..750 CDD:270946
Pkinase_Tyr 502..745 CDD:285015
CYCc 788..979 CDD:214485
Guanylate_cyc 815..1002 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.