DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and GUCY1A2

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001243353.1 Gene:GUCY1A2 / 2977 HGNCID:4684 Length:763 Species:Homo sapiens


Alignment Length:202 Identity:39/202 - (19%)
Similarity:68/202 - (33%) Gaps:67/202 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EAICDANGRNCTIRALVLLPDDNMYQASLPRVLPI----LKVAE-------------QQIRSKSL 77
            :|.|.|.|               :::.||....||    ||:.|             |..||:.|
Human   570 DAYCVAAG---------------LHRKSLCHAKPIALMALKMMELSEEVLTPDGRPIQPQRSELL 619

  Fly    78 IPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGPV-------CDYSLAAVSRITKYFNS 135
            ....:..:.:....:.:..||..|...||  ....|:.|.|       |.:. ..|:..:|:.:.
Human   620 FSFPVSIQLVPDQHQSETDLGTEKMRIGI--HSGSVLAGVVGVRMPRYCLFG-NNVTLASKFESG 681

  Fly   136 QGTPLISVGGSTYD----------FEQKKTDCNDEF---------YMLLRTG------MLSFETI 175
            .....|:|..:||.          ..:.:.:..|.|         ::.:|||      .||...|
Human   682 SHPRRINVSPTTYQLLKREESFTFIPRSREELPDNFPKEIPGICYFLEVRTGPKPPKPSLSSSRI 746

  Fly   176 SELTINV 182
            .:::.|:
Human   747 KKVSYNI 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 35/186 (19%)
GUCY1A2NP_001243353.1 HNOB <159..270 CDD:285002
HNOBA 316..503 CDD:285003
CYCc 485..705 CDD:214485 30/152 (20%)
Guanylate_cyc 514..729 CDD:278633 32/176 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.