DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14877 and Adcy8

DIOPT Version :9

Sequence 1:	NP_650507.1	Gene:	CG14877 / 41929	FlyBaseID:	FBgn0038380	Length:	254	Species:	Drosophila melanogaster
Sequence 2:	NP_058838.1	Gene:	Adcy8 / 29241	RGDID:	2036	Length:	1248	Species:	Rattus norvegicus

Alignment Length:	176	Identity:	37/176 - (21%)
Similarity:	69/176 - (39%)	Gaps:	55/176 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly   102 AMDGII--KQCAQVIFGPVC---DYSLA---AVSRITKY-FN--------SQGT----------P 139
            |:.|:.  ||..:..:|.:|   |:|||   ::..|.|: ||        |.|:          |
  Rat  1039 AVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKP 1103

  Fly   140 LISVGGSTYDFEQK--------KTDCNDEFYMLLRTGMLSFETISELTI-NVMKRHNWSHSIFYY 195
            ...:.|.|.:...:        :....:|.|::|:....:|:...|:.: .:.::.....:.|..
  Rat  1104 QYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIYVKGISEQEGKIKTYFLL 1168

  Fly   196 ER-------------DGQRSVAGMHTCFLMMKSLG----KQMRNEN 224
            .|             .||.|:|.:  ...:::||.    ||:.|||
  Rat  1169 GRVQPNPFILPPRRLPGQYSLAAV--VLGLVQSLNRQRQKQLLNEN 1212

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14877	NP_650507.1	Periplasmic_Binding_Protein_Type_1	46..>241	CDD:299141	37/176 (21%)
Adcy8	NP_058838.1	Involved in ORAI1, STIM1, PPP2CA and PPP2R1A interaction. /evidence=ECO:0000269\|PubMed:16258073, ECO:0000269\|PubMed:22494970, ECO:0000269\|PubMed:22976297	1..179
		Involved in AKAP5 and PRKAR2A interaction. /evidence=ECO:0000269\|PubMed:22976297	1..106
		Essential for CALM1 interaction. /evidence=ECO:0000269\|PubMed:16258073	38..40
		Essential for CALM1 interaction. /evidence=ECO:0000269\|PubMed:16258073	49..51
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	51..117
		AC_N	<158..397	CDD:292831
		CYCc	363..561	CDD:214485
		Guanylate_cyc	402..586	CDD:278633
		DUF1053	614..708	CDD:283888
		CYCc	941..1145	CDD:214485	22/105 (21%)
		Guanylate_cyc	970..1169	CDD:278633	25/129 (19%)
		Involved in CALM1 interaction. /evidence=ECO:0000269\|PubMed:16258073	1106..1248		20/109 (18%)
		Required for both calcium stimulation and maintenance of autoinhibition. /evidence=ECO:0000269\|PubMed:19305019	1197..1212		5/14 (36%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1220..1248
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2114
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900