DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and Adcy10

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_766617.2 Gene:Adcy10 / 271639 MGIID:2660854 Length:1614 Species:Mus musculus


Alignment Length:155 Identity:33/155 - (21%)
Similarity:58/155 - (37%) Gaps:35/155 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DGIIKQCAQVI-FGPVCDYSLAAVSRITKYFNSQ--GTPLISVGGSTYDFEQKKTDCNDEFY--M 163
            |.::..|::|: :..:..|..:.|....:|..||  ....:::..:...|.|       .||  .
Mouse   502 DFLMTNCSRVLMYEGLPGYGKSQVLMEIEYLASQHENHRAVAIALTKISFHQ-------NFYTIQ 559

  Fly   164 LLRTGMLSFET---ISELTINVMKR---------HNWSHSIFYYERDGQRSVAGMHTC------- 209
            :|...:|..:|   ..|...|:..|         |...:.||:.:....|.::.|...       
Mouse   560 ILMANVLGLDTCKHYKERQTNLQNRVKTLLDEKFHCLLNDIFHVQFPVSREMSRMSKIRKQKQLE 624

  Fly   210 FLMMKSLGKQMRNENMTF----AQF 230
            .|.||.|.:.:|.|.:.|    |||
Mouse   625 ALFMKILAQTVREERIIFIIDEAQF 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 33/155 (21%)
Adcy10NP_766617.2 CHD 40..214 CDD:143636
CHD 292..461 CDD:143636
COG3899 485..>959 CDD:226415 33/155 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.