DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and Gucy2c

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_037302.1 Gene:Gucy2c / 25711 RGDID:2771 Length:1072 Species:Rattus norvegicus


Alignment Length:232 Identity:46/232 - (19%)
Similarity:91/232 - (39%) Gaps:56/232 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NCTIRALVLLPDDNMYQASLPRVLPI----LKVAEQQIRSKSL-IPSHIDF---EWLAHDTKCDA 95
            |.|....||:.|::.|:..|..:...    |.:..:::|...| :..:..|   :.|.|.:. |.
  Rat    31 NGTYEISVLMMDNSAYKEPLQNLRDAVEEGLDIVRKRLREAELNVTVNATFIYSDGLIHKSG-DC 94

  Fly    96 SLGVIKAMDGIIKQCAQ------VIFGPVCDYSLAAVSRITKYFNSQ-GTPLISVG--GSTYDFE 151
            .....:.:| ::::..:      |:.||.|.|     |....|.::: ..|:||.|  |.:.|::
  Rat    95 RSSTCEGLD-LLREITRDRKMGCVLMGPSCTY-----STFQMYLDTELNYPMISAGSFGLSCDYK 153

  Fly   152 QKKT----DCNDEFYMLL---RTGMLSFETISELTINVMKRHNWSHSIFYYERDGQRSVAGMHTC 209
            :..|    ......|.|:   :.....|:|.|           |:.|..|  ::|...    ..|
  Rat   154 ETLTRILPPARKLMYFLVDFWKVNNAPFKTFS-----------WNSSYVY--KNGSEP----EDC 201

  Fly   210 FLMMKSL--GKQMRNENMTFAQFPLEPNLTNRTEEMR 244
            |..:.:|  |....:|.::|      .::..|:|:.:
  Rat   202 FWYLNALEAGVSYFSEVLSF------KDVLRRSEQFQ 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 43/220 (20%)
Gucy2cNP_037302.1 Periplasmic_Binding_Protein_Type_1 34..414 CDD:299141 44/229 (19%)
PKc_like 479..749 CDD:304357
STYKc 501..744 CDD:214568
CYCc 787..978 CDD:214485
Guanylate_cyc 814..1001 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.