DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14877 and Phlpp2

DIOPT Version :9

Sequence 1:	NP_650507.1	Gene:	CG14877 / 41929	FlyBaseID:	FBgn0038380	Length:	254	Species:	Drosophila melanogaster
Sequence 2:	NP_001116066.2	Gene:	Phlpp2 / 244650	MGIID:	2444928	Length:	1355	Species:	Mus musculus

Alignment Length:	150	Identity:	36/150 - (24%)
Similarity:	54/150 - (36%)	Gaps:	43/150 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly    55 QASLPRVLPIL--KVAEQQIRSKSLIPS---------HIDFEWLAHDTKC--DASLGVIKAMDGI 106
            |.....:||::  |:.|.:.|..||..|         |:.||.||...:.  .||..|.:.|..:
Mouse   222 QTGKMHILPLVGGKIEEVKRRQHSLAFSSAGAQAQTYHVSFETLAEYQRWQRQASKVVSQRMSTV 286

  Fly   107 IKQCAQVIFGPVCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLS 171
            ...|          |||..|..  ..|.||....:::              ...|..|.|.|.|
Mouse   287 DLSC----------YSLEEVPE--HLFYSQDITYLNL--------------RHNFMQLERPGGL- 324

  Fly   172 FETISELTINVMKRHNWSHS 191
             :|:.:  .:.:|..|.||:
Mouse   325 -DTLHK--FSQLKGLNLSHN 341

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14877	NP_650507.1	Periplasmic_Binding_Protein_Type_1	46..>241	CDD:299141	36/149 (24%)
Phlpp2	NP_001116066.2	PH_PHLPP-like	181..275	CDD:270131	14/52 (27%)
		leucine-rich repeat	285..305	CDD:275380	7/31 (23%)
		leucine-rich repeat	306..332	CDD:275380	6/43 (14%)
		LRR_RI	309..548	CDD:238064	10/50 (20%)
		LRR_8	354..412	CDD:290566
		leucine-rich repeat	356..378	CDD:275380
		leucine-rich repeat	379..401	CDD:275380
		leucine-rich repeat	402..424	CDD:275380
		LRR_8	425..483	CDD:290566
		leucine-rich repeat	425..448	CDD:275380
		LRR_RI	447..714	CDD:238064
		leucine-rich repeat	449..472	CDD:275380
		leucine-rich repeat	474..493	CDD:275380
		leucine-rich repeat	494..513	CDD:275380
		leucine-rich repeat	514..535	CDD:275380
		LRR_8	536..592	CDD:290566
		leucine-rich repeat	536..558	CDD:275380
		leucine-rich repeat	559..581	CDD:275380
		leucine-rich repeat	582..597	CDD:275380
		LRR_8	604..664	CDD:290566
		leucine-rich repeat	604..627	CDD:275380
		leucine-rich repeat	628..653	CDD:275380
		leucine-rich repeat	654..677	CDD:275380
		LRR_8	676..735	CDD:290566
		leucine-rich repeat	678..701	CDD:275380
		leucine-rich repeat	702..724	CDD:275380
		leucine-rich repeat	747..768	CDD:275380
		PP2Cc	816..1065	CDD:238083
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2114
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900