DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and Gucy1b2

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_011243363.2 Gene:Gucy1b2 / 239134 MGIID:2660873 Length:829 Species:Mus musculus


Alignment Length:248 Identity:47/248 - (18%)
Similarity:82/248 - (33%) Gaps:86/248 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ICDA-NGRNCTIRALVLL---PDDNMYQASLPRVLPILKVAEQQIRSKSLIPSHIDFEWLAHDTK 92
            :|.. ...:..:||.|||   |..:.:|...|..|.|    |:::...: .|.|:.|:......:
Mouse   341 VCPGEKSHSAVVRASVLLGKGPLGDTFQPVFPERLWI----EEEVFCNA-FPFHVVFDEALRVKQ 400

  Fly    93 CDASLGVIKAMDGIIKQ-----------CAQVIFGPVCDYSLAAVSRITKYFNSQGTPLISVGGS 146
              |.:.:.|.:.||:.|           ..||.|.         :|.|.|:.|||          
Mouse   401 --AGVNIQKYVPGILTQKFGLDEYFSIVHPQVTFN---------ISSICKFINSQ---------- 444

  Fly   147 TYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNWSHSIFYYERDGQRSVAGMHTCFL 211
                          |.:..|..|:.....|:.|:.:..:..|..|:        :.:..|  |..
Mouse   445 --------------FILKTRREMMPEAWKSQPTLKLRGQMIWMESL--------KCMVFM--CSP 485

  Fly   212 MMKSLGKQMRNENM--------------------TFAQFPLEPNLTNRTEEMR 244
            .::|| :::....|                    ..|:..|...|..:.||:|
Mouse   486 KLRSL-QELEESKMHLSDIAPHDTTRDLILLNQQRLAEMELSCQLEKKKEELR 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 41/228 (18%)
Gucy1b2XP_011243363.2 HNOB 115..276 CDD:400167
HNOBA 380..566 CDD:400168 35/205 (17%)
Guanylate_cyc 572..754 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.