DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and PHLPP1

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_919431.2 Gene:PHLPP1 / 23239 HGNCID:20610 Length:1717 Species:Homo sapiens


Alignment Length:99 Identity:27/99 - (27%)
Similarity:43/99 - (43%) Gaps:25/99 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NC--TIRALVLLPDDNMYQASLPRVLPILKVAEQQIR-SKSLIPSHIDFEWLAHDTKCDA---SL 97
            ||  |:|...|            |.:|.:|..:.::. .:.||...:||  |.|.|:.|.   .|
Human   793 NCVETLRLQAL------------RKMPHIKHVDLRLNVIRKLIADEVDF--LQHVTQLDLRDNKL 843

  Fly    98 GVIKAM--DGI-IKQCA--QVIFGPVCDYSLAAV 126
            |.:.||  :.| :..|.  |::...:|.|.|.|:
Human   844 GDLDAMIFNNIEVLHCERNQLVTLDICGYFLKAL 877

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 23/90 (26%)
PHLPP1NP_919431.2 leucine-rich repeat 1107..1129 CDD:275380
PP2Cc 1168..1420 CDD:214625
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1458..1510
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1673..1717
PDZ-binding, required for interaction with SLC9A3R1. /evidence=ECO:0000269|PubMed:21804599 1715..1717
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..118
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..156
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..470
PH_PHLPP-like 535..631 CDD:270131
PH 555..636 CDD:278594
LRR_RI 625..929 CDD:238064 27/99 (27%)
LRR_8 638..703 CDD:290566
LRR 1 638..659
leucine-rich repeat 641..661 CDD:275380
LRR 2 661..682
leucine-rich repeat 662..692 CDD:275380
LRR 3 692..712
leucine-rich repeat 693..738 CDD:275380
LRR_8 714..770 CDD:290566
LRR 4 715..736
LRR 5 738..760
leucine-rich repeat 739..761 CDD:275380
LRR 6 761..783
leucine-rich repeat 762..784 CDD:275380
LRR 7 784..804 5/22 (23%)
leucine-rich repeat 785..808 CDD:275380 6/26 (23%)
LRR 8 808..831 5/24 (21%)
leucine-rich repeat 810..832 CDD:275380 6/23 (26%)
LRR_RI 814..1074 CDD:238064 19/66 (29%)
LRR 9 832..853 7/20 (35%)
leucine-rich repeat 833..853 CDD:275380 6/19 (32%)
leucine-rich repeat 854..895 CDD:275380 7/24 (29%)
LRR 10 873..894 2/5 (40%)
LRR 11 895..916
leucine-rich repeat 896..918 CDD:275380
LRR 12 918..939
leucine-rich repeat 919..941 CDD:275380
LRR 13 941..962
leucine-rich repeat 942..963 CDD:275380
LRR_8 962..1024 CDD:290566
LRR 14 963..984
leucine-rich repeat 964..987 CDD:275380
LRR 15 987..1008
leucine-rich repeat 988..1011 CDD:275380
LRR 16 1013..1033
LRR_8 1014..1072 CDD:290566
leucine-rich repeat 1014..1037 CDD:275380
LRR 17 1037..1058
leucine-rich repeat 1038..1061 CDD:275380
LRR 18 1061..1082
Interaction with SLC9A3R1. /evidence=ECO:0000269|PubMed:21804599 1076..1205
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.