DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14877 and Adcy2

DIOPT Version :9

Sequence 1:	NP_650507.1	Gene:	CG14877 / 41929	FlyBaseID:	FBgn0038380	Length:	254	Species:	Drosophila melanogaster
Sequence 2:	NP_705762.2	Gene:	Adcy2 / 210044	MGIID:	99676	Length:	1095	Species:	Mus musculus

Alignment Length:	99	Identity:	19/99 - (19%)
Similarity:	34/99 - (34%)	Gaps:	35/99 - (35%)

- Green bases have known domain annotations that are detailed below.

  Fly    75 KSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQ---CAQVIFGPVCDYS-------------- 122
            ::::|:|:...:||...|          .:.:..|   |..|:|..:.|:.
Mouse   861 ENVLPAHVAEHFLARSLK----------NEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLE 915

  Fly   123 -LAAVSRITKYFNS-------QGTPLISVGGSTY 148
             |..::.|...|:.       .|...|...||||
Mouse   916 CLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTY 949

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14877	NP_650507.1	Periplasmic_Binding_Protein_Type_1	46..>241	CDD:299141	19/99 (19%)
Adcy2	NP_705762.2	AC_N	<37..264	CDD:292831
		CYCc	240..443	CDD:214485
		Guanylate_cyc	285..469	CDD:278633
		DUF1053	499..603	CDD:283888
		CYCc	852..1060	CDD:214485	19/99 (19%)
		Guanylate_cyc	882..1081	CDD:278633	14/68 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2114
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900