DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and ADCY4

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001185497.1 Gene:ADCY4 / 196883 HGNCID:235 Length:1077 Species:Homo sapiens


Alignment Length:270 Identity:53/270 - (19%)
Similarity:84/270 - (31%) Gaps:114/270 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IRALVLLP--DDNMYQA------------SLPRVLPILKVAEQQ------IRSKSLIPSHIDFE- 85
            |.:|...|  .|..:||            .||..||::.|....      ..|.||. .|:.|| 
Human   679 ITSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPYSMHCCTLGFLSCSLF-LHMSFEL 742

  Fly    86 -------WLA-------HD----TKC---DASLGVIKAMDGIIKQCAQVIFGPVC----DYSLAA 125
                   |||       |.    ::|   ...||.:.:..|::|:  ..:.|.:.    .::|..
Human   743 KLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGPLDSRPGVLKE--PKLMGAISFFIFFFTLLV 805

  Fly   126 VSRITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELT----INVMKRH 186
            ::|..:|:            ...||..||.         ||......||:..||    .||:..|
Human   806 LARQNEYY------------CRLDFLWKKK---------LRQEREETETMENLTRLLLENVLPAH 849

  Fly   187 NWSHSIFYYERDGQRSVAGMHTCFLMMKSLGKQMRNENM----------------TFAQFPLEPN 235
                                    :..:.:|:..|||::                .|.:|..|.|
Human   850 ------------------------VAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESN 890

  Fly   236 LTNRTEEMRR 245
            :.:...|..|
Human   891 INHEGLECLR 900

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 49/260 (19%)
ADCY4NP_001185497.1 AC_N <115..246 CDD:292831
CYCc 219..422 CDD:214485
Guanylate_cyc 264..418 CDD:278633
DUF1053 479..583 CDD:283888
CYCc 827..1042 CDD:214485 17/98 (17%)
Guanylate_cyc 864..1063 CDD:278633 6/37 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.