DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gcy-37

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_500171.2 Gene:gcy-37 / 191658 WormBaseID:WBGene00001557 Length:708 Species:Caenorhabditis elegans


Alignment Length:139 Identity:28/139 - (20%)
Similarity:48/139 - (34%) Gaps:42/139 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LPDDNMY--QASLPRVLPILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQ- 109
            :|:.|.|  :.||...|.:|..|:|.:..|           |....:....:.....:.||:.| 
 Worm   491 VPNANQYHCEDSLNLALGLLFEAKQVVVPK-----------LERSVRLRIGVHCGPVVAGIVSQQ 544

  Fly   110 ----CAQVIFG-------PVCDYSL--------AAVSRITKY------FNSQGTPLISVGGSTYD 149
                |   :.|       .:|.:|.        |..:.:||:      ||:.|...:..|.....
 Worm   545 KPRFC---VLGNTVNVTKSICSHSSPGKVLVSNAVRTMVTKHLKSIFVFNANGYLELQSGKVLTH 606

  Fly   150 FEQKKTDCN 158
            |.:|...|:
 Worm   607 FLEKNEKCS 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 28/139 (20%)
gcy-37NP_500171.2 HNOB 3..165 CDD:285002
HNOBA 223..419 CDD:285003
CYCc 400..577 CDD:214485 19/99 (19%)
Nucleotidyl_cyc_III 425..609 CDD:299850 26/131 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.