Sequence 1: | NP_650507.1 | Gene: | CG14877 / 41929 | FlyBaseID: | FBgn0038380 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506319.1 | Gene: | gcy-34 / 191656 | WormBaseID: | WBGene00001554 | Length: | 686 | Species: | Caenorhabditis elegans |
Alignment Length: | 244 | Identity: | 50/244 - (20%) |
---|---|---|---|
Similarity: | 75/244 - (30%) | Gaps: | 107/244 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 DNMYQASLPRVLPILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIF 115
Fly 116 GPVCD------------------------YSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTD 156
Fly 157 CNDEFYM----------------LLRTGMLSFETISELTINVMKRH------------------- 186
Fly 187 ------NWSHS------IFYYERDGQRSVAG---MHTCFLMMKSLGKQM 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14877 | NP_650507.1 | Periplasmic_Binding_Protein_Type_1 | 46..>241 | CDD:299141 | 50/244 (20%) |
gcy-34 | NP_506319.1 | HNOB | 3..167 | CDD:285002 | |
HNOBA | 224..441 | CDD:285003 | 6/19 (32%) | ||
CYCc | 421..609 | CDD:214485 | 40/214 (19%) | ||
Guanylate_cyc | 453..629 | CDD:278633 | 36/199 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |