DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gcy-34

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_506319.1 Gene:gcy-34 / 191656 WormBaseID:WBGene00001554 Length:686 Species:Caenorhabditis elegans


Alignment Length:244 Identity:50/244 - (20%)
Similarity:75/244 - (30%) Gaps:107/244 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DNMYQASLPRVLPILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIF 115
            |::.:..|||     |:|:|.:..:.|.|.    |:.|....||     :.|...||        
 Worm   426 DSILKDMLPR-----KIAKQLLSGEHLEPC----EYEATVMFCD-----LPAFQQII-------- 468

  Fly   116 GPVCD------------------------YSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTD 156
             |||.                        |.:..||  ..|....|.|       .|..|..:..
 Worm   469 -PVCQPKNIVKLLNEVFFKLDRIVVLRGVYKVETVS--DSYMTVSGIP-------DYTSEHAENM 523

  Fly   157 CNDEFYM----------------LLRTGMLSFETISELTINVMKRH------------------- 186
            |:....|                |||.|:.|...|:.:....|.|:                   
 Worm   524 CHVALGMMWEARSVMDPVNKTPFLLRIGLHSGTIIAGVVGTKMPRYCLFGETVTLASQMESLGVA 588

  Fly   187 ------NWSHS------IFYYERDGQRSVAG---MHTCFLMMKSLGKQM 220
                  :|::|      .|.:...|:.:|.|   :.|.|| |:||.|.:
 Worm   589 GKIQCSSWTYSKAMETGRFEFSPRGRINVKGRGDVETYFL-MRSLKKSI 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 50/244 (20%)
gcy-34NP_506319.1 HNOB 3..167 CDD:285002
HNOBA 224..441 CDD:285003 6/19 (32%)
CYCc 421..609 CDD:214485 40/214 (19%)
Guanylate_cyc 453..629 CDD:278633 36/199 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.