DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gcy-21

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001364740.1 Gene:gcy-21 / 191651 WormBaseID:WBGene00001546 Length:1163 Species:Caenorhabditis elegans


Alignment Length:243 Identity:48/243 - (19%)
Similarity:86/243 - (35%) Gaps:78/243 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EEPARDCEAICDANGRNCTIRALV--------LLPDDNMYQASLPRVLPILKVAEQQIRSKSLIP 79
            ::||:.|...|     |.|:...:        ||.|...|.|....  ..|.:      ..::..
 Worm   335 KKPAKMCPPYC-----NTTVSEKITPRWDRIKLLFDSIQYLADATN--DALNI------GANIYQ 386

  Fly    80 SHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGPVC---------------DYSLAAVSRI 129
            |.|.:|:|. ..|.|:..||.:.:||         :|.:.               .|||...:|:
 Worm   387 SDIFYEYLI-SRKIDSVTGVTEFIDG---------YGAIVGSIQIYYHFSSSSHNSYSLFPCARL 441

  Fly   130 TKYFNSQGTPLISV-------GGSTYDFEQKKT------------DC----NDEFYMLLRTGMLS 171
                 :|.:.|.:|       .|.:.||..|..            :|    |:.|.:::..|:..
 Worm   442 -----AQSSLLNTVWSLTDYSEGLSIDFVNKSAPKDTPVCGFYGENCGPPANNTFIIVISVGVAV 501

  Fly   172 FETISELTINVMKRHNWS---HSIFYYERDGQRSVAGMHTCFLMMKSL 216
            ...::.....:.||:.:.   ||:|:. .|..:.:...||..:..:||
 Worm   502 LIGLAIAAAFLYKRYRYERRLHSLFFM-IDRNQIILKKHTNLMSQQSL 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 42/220 (19%)
gcy-21NP_001364740.1 Periplasmic_Binding_Protein_type1 58..422 CDD:415822 23/109 (21%)
PK_GC 612..881 CDD:270894
HNOBA <890..938 CDD:400168
Guanylate_cyc 944..1130 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.