DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gcy-19

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001348702.1 Gene:gcy-19 / 191650 WormBaseID:WBGene00001544 Length:1187 Species:Caenorhabditis elegans


Alignment Length:210 Identity:51/210 - (24%)
Similarity:84/210 - (40%) Gaps:29/210 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLVLLLVG-LVFGPK--------DCVATCREEPARDCEAICDANGRNCTIR-ALVLLPDDNMYQ 55
            :|.:||..| |.|.|:        ....|....||        ||.|  ||| .:..:....:..
 Worm     4 LLFLLLFAGFLTFLPRFLIYAQITSSTTTTTPVPA--------ANRR--TIRVGVAAVQTTELDS 58

  Fly    56 ASLPRVLPILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGPVCD 120
            ...|.....:.:|.|::|....| :..|||...:.|:||.|||....|:.:..:...|:.||.|.
 Worm    59 IGWPMSGGAINMAIQKLRDDGFI-APFDFEVTVNYTECDRSLGAAVGMEFMRTKRLDVVIGPPCR 122

  Fly   121 YSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKR 185
            ..:..::.:..|::   ||::..|..|   :.|.||  .|.|..|...|.:..::....:.:::.
 Worm   123 DPMEIMATMATYYS---TPMLGWGLVT---DSKFTD--TERYPYLTNIMANSLSLGFSLVKLLEM 179

  Fly   186 HNWSHSIFYYERDGQ 200
            ..|......||...|
 Worm   180 MEWDRVALVYEESAQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 35/155 (23%)
gcy-19NP_001348702.1 PBP1_NPR_GC_like 45..467 CDD:107347 36/159 (23%)
PKc_like 571..841 CDD:328722
CYCc 876..1065 CDD:214485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.