DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gcy-17

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001293327.1 Gene:gcy-17 / 191649 WormBaseID:WBGene00001542 Length:1088 Species:Caenorhabditis elegans


Alignment Length:232 Identity:54/232 - (23%)
Similarity:93/232 - (40%) Gaps:54/232 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NCTIRALV---LLPDDNM--------YQASLPRVLPILKVAEQQIRSKSLIPSHIDFEWLAHDTK 92
            ||..|..:   ||...|:        |:.|...||    |.:.:||...::.. .|||:|....:
 Worm    17 NCQARRTIKVGLLFVQNVSSLQVGIGYRTSAAAVL----VTKNKIREDHVLDG-FDFEFLWDFDE 76

  Fly    93 CDASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTDC 157
            |:..||..|.:|.:..:...|||||.|.......|.:..|:|   .|:...|.::   .::.||.
 Worm    77 CNEILGAGKTVDLLEVKKVDVIFGPTCSRPALISSALATYYN---IPIFEWGLTS---TRQLTDV 135

  Fly   158 NDEFYMLLRTGMLSFETISELTINVMKRHNWSHSIFYYERDGQ-----------RSVAGMHTCFL 211
            . .|...|...:.|: :::...:..:|:..|:..:|.|..||.           ::||..|    
 Worm   136 K-RFPTTLPFSVNSY-SLAMAILGTLKQFQWTEFVFLYCNDGDDEKCESLKDDVQTVASAH---- 194

  Fly   212 MMKSLGKQMRNENMTFA-QFPLEPNLTNRTEEMRREI 247
                       |.::.| .|.::   :.:.|:||..|
 Worm   195 -----------EELSLAYTFRIQ---SKKLEDMRAAI 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 47/217 (22%)
gcy-17NP_001293327.1 Periplasmic_Binding_Protein_Type_1 25..404 CDD:299141 51/224 (23%)
ANF_receptor 47..398 CDD:279440 46/202 (23%)
PKc_like 539..808 CDD:304357
Pkinase 567..803 CDD:278497
HNOBA <824..867 CDD:285003
CYCc 846..1038 CDD:214485
Guanylate_cyc 873..1060 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.