DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gcy-15

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001364713.1 Gene:gcy-15 / 191648 WormBaseID:WBGene00001541 Length:1104 Species:Caenorhabditis elegans


Alignment Length:244 Identity:49/244 - (20%)
Similarity:86/244 - (35%) Gaps:78/244 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 REEPARDCEAICDANGRNCTIRALV--------LLPDDNMYQASLPRVLPILKVAEQQIRSKSLI 78
            :::||:.|...|     |.||...:        ||.|...|.|....  ..|.:      ..::.
 Worm   275 KKKPAKMCPPYC-----NTTISEKITPRWDRIKLLFDSIQYLADATN--DALNI------GANIY 326

  Fly    79 PSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGPVC---------------DYSLAAVSR 128
            .|.|.:|.|. ..|.|:..||.:.:||         :|.:.               .|||...:|
 Worm   327 QSDIFYEHLI-SRKVDSVTGVTEYIDG---------YGAIVGSMQIYYHFSSSSHNSYSLFPCAR 381

  Fly   129 ITKYFNSQGTPLISV-------GGSTYDFEQKKT------------DC----NDEFYMLLRTGML 170
            :     :|.:.|.:|       .|.:.||..|..            :|    |:.|.:::..|:.
 Worm   382 L-----AQSSLLNTVWSLTDYSEGLSIDFVNKSAPKDTPVCGFYGENCGPPANNTFIIVISVGVA 441

  Fly   171 SFETISELTINVMKRHNWS---HSIFYYERDGQRSVAGMHTCFLMMKSL 216
            ....::.....:.||:.:.   ||:|:. .|..:.:...||..:..:||
 Worm   442 VLIGLAIAAAFLYKRYRYERRLHSLFFM-IDRNQIILKKHTNLMSQQSL 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 42/220 (19%)
gcy-15NP_001364713.1 Periplasmic_Binding_Protein_type1 2..363 CDD:415822 24/110 (22%)
PK_GC 553..822 CDD:270894
HNOBA <831..879 CDD:400168
Guanylate_cyc 885..1071 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.