DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gcy-14

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_506660.2 Gene:gcy-14 / 191647 WormBaseID:WBGene00001540 Length:1111 Species:Caenorhabditis elegans


Alignment Length:244 Identity:58/244 - (23%)
Similarity:89/244 - (36%) Gaps:64/244 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLVLLL--------------VGLVFGPKDCVATCREEPARDCEAICDANGRNCTIRALVLLPDD 51
            |.|.|||              |||:|             ::|..::..|.|              
 Worm     1 MCLFLLLFPYLASGQFLQTVKVGLLF-------------SKDTASVMRAVG-------------- 38

  Fly    52 NMYQASLPRVLPILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFG 116
              |:.|...||    ||..:||::.|:..: ||.:.....:|...|...|.::.|......||.|
 Worm    39 --YRTSAAAVL----VARDRIRAEHLLDQY-DFNFTVKFDECTEGLAGGKTVELINHDNVDVIIG 96

  Fly   117 PVCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTDC-NDEFYMLLRTGMLSFETISELTI 180
            |.|:.:..||:.:..|:|   .|:...|.:|      ..|. |...|....|..|...:::....
 Worm    97 PTCNRAGIAVASLAAYYN---VPVFQWGLTT------AADIGNVSRYPTTVTLSLDTHSMALGVR 152

  Fly   181 NVMKRHNWSHSIFYYERDGQRSVAGMHTCFLMMKSLGKQ-MRNENMTFA 228
            .|::|..|...:|.|..||..     ..|..|...|.|. :.|.::|.|
 Worm   153 EVLRRFEWDEFVFIYSNDGDE-----EKCASMKDDLEKMGIENSDVTLA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 46/185 (25%)
gcy-14NP_506660.2 PBP1_NPR_GC_like 21..423 CDD:107347 53/224 (24%)
ANF_receptor 43..418 CDD:279440 44/173 (25%)
PKc_like 535..800 CDD:304357
HNOBA <817..860 CDD:285003
CYCc 839..1031 CDD:214485
Guanylate_cyc 866..1053 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.876977 Normalized mean entropy S7115
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.