DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gcy-9

DIOPT Version :10

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_509897.3 Gene:gcy-9 / 191645 WormBaseID:WBGene00001536 Length:1081 Species:Caenorhabditis elegans


Alignment Length:128 Identity:24/128 - (18%)
Similarity:52/128 - (40%) Gaps:15/128 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSR 128
            :||:....::.::::|.:........:: |:...||..|......:.|.|.|||.|:..:..:.|
 Worm    60 VLKMCADDLKMRNILPQNYTLTVFTMES-CNKYSGVEHAAFLHYLKNASVYFGPGCNNEMLVIGR 123

  Fly   129 ITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISEL---TINVMKRHNW 188
            :...:|   .|:|:        .....|...:.......|.::..:.||:   |:..:..:||
 Worm   124 LAPRWN---VPIIA--------HMSGDDALSDRVQFPTLGSVALTSASEMAKATVTYLNLNNW 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_type1 45..>251 CDD:471960 24/128 (19%)
gcy-9NP_509897.3 PBP1_NPR_GC-like 66..416 CDD:380575 22/122 (18%)
Protein Kinases, catalytic domain 550..820 CDD:473864
HNOBA <835..883 CDD:462234
CYCc 862..1054 CDD:214485
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.