DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gcy-3

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_496037.1 Gene:gcy-3 / 191641 WormBaseID:WBGene00001530 Length:1140 Species:Caenorhabditis elegans


Alignment Length:162 Identity:32/162 - (19%)
Similarity:68/162 - (41%) Gaps:36/162 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PILKV---AEQQIRSKSL--------IP------------SHIDFEWLAHDTKCDASLGVIKAMD 104
            |.|||   |.|:.:|.|:        :|            ::.|||:....|:||.:..|...::
 Worm    33 PKLKVGIAAAQKTQSASIGWNVCGGAVPLAIERLKQAGYVTNFDFEYYVEYTECDLASTVRTGIN 97

  Fly   105 GIIKQCAQVIFGPVCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTDCND--EFYMLLRT 167
            .:......||.||.|..::..::.:...:..   |::..|..:      :.|.:|  .|..|: |
 Worm    98 FLKNLEVDVIIGPPCSEAIRTMATLATLYKK---PVLGWGFVS------QADLSDMTRFPYLI-T 152

  Fly   168 GMLSFETISELTINVMKRHNWSH-SIFYYERD 198
            .:.:.:|:......:::.:.|.. ::.||:.:
 Worm   153 VLPTSQTLGYAASKLLELYKWDKVALLYYKSE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 32/162 (20%)
gcy-3NP_496037.1 PBP1_NPR_GC_like 36..453 CDD:107347 30/159 (19%)
ANF_receptor 54..433 CDD:279440 24/141 (17%)
PKc_like 554..823 CDD:304357
HNOBA <839..882 CDD:285003
CYCc 861..1051 CDD:214485
Guanylate_cyc 888..1076 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.