DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gcy-3

DIOPT Version :10

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_496037.1 Gene:gcy-3 / 191641 WormBaseID:WBGene00001530 Length:1140 Species:Caenorhabditis elegans


Alignment Length:162 Identity:32/162 - (19%)
Similarity:68/162 - (41%) Gaps:36/162 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PILKV---AEQQIRSKSL--------IP------------SHIDFEWLAHDTKCDASLGVIKAMD 104
            |.|||   |.|:.:|.|:        :|            ::.|||:....|:||.:..|...::
 Worm    33 PKLKVGIAAAQKTQSASIGWNVCGGAVPLAIERLKQAGYVTNFDFEYYVEYTECDLASTVRTGIN 97

  Fly   105 GIIKQCAQVIFGPVCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTDCND--EFYMLLRT 167
            .:......||.||.|..::..::.:...:..   |::..|..:      :.|.:|  .|..|: |
 Worm    98 FLKNLEVDVIIGPPCSEAIRTMATLATLYKK---PVLGWGFVS------QADLSDMTRFPYLI-T 152

  Fly   168 GMLSFETISELTINVMKRHNWSH-SIFYYERD 198
            .:.:.:|:......:::.:.|.. ::.||:.:
 Worm   153 VLPTSQTLGYAASKLLELYKWDKVALLYYKSE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_type1 45..>251 CDD:471960 32/162 (20%)
gcy-3NP_496037.1 PBP1_NPR_GC-like 36..452 CDD:380575 30/159 (19%)
Protein Kinases, catalytic domain 554..823 CDD:473864
HNOBA <838..882 CDD:462234
CYCc 861..1051 CDD:214485
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.