DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gcy-1

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_496039.1 Gene:gcy-1 / 191639 WormBaseID:WBGene00001528 Length:1137 Species:Caenorhabditis elegans


Alignment Length:219 Identity:48/219 - (21%)
Similarity:80/219 - (36%) Gaps:63/219 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LPDDNMYQASLPRVLPILKV---AEQQIRSKSL--------IPSHI------------DFEWLAH 89
            |||..:    .||....:|:   |.|:|::.|:        :|..|            |||::..
 Worm    21 LPDTTV----APRTKRTIKIGIAAAQRIQTSSIGWSVCGGAVPLAIERLKEMGFVKDFDFEYIVD 81

  Fly    90 DTKCDASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKK 154
            .|:||....|...|:.|......||.||.|..:|..:|.:.:.:..   |::..|..:      .
 Worm    82 YTECDLGSVVRAGMEFIKTHKVDVIIGPPCAQALRLMSFLAENYKK---PVLGWGFVS------D 137

  Fly   155 TDCNDEF------YMLLRTGMLSFETISELTINVMKRHNWSH-SIFYYERDGQRSVAGMHTCFLM 212
            ||.:|..      .::..:.||.:.....||     ..:|:. ::.||..|              
 Worm   138 TDLSDVIRFPHLTTVIPNSLMLGYAASKMLT-----TFHWNRVALLYYFSD-------------- 183

  Fly   213 MKSLGKQMRNENMTFAQFPLEPNL 236
            :|.....|.:...||.. |..||:
 Worm   184 VKYCSGVMNDIEATFND-PSTPNV 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 48/219 (22%)
gcy-1NP_496039.1 PBP1_NPR_GC_like 35..449 CDD:107347 43/201 (21%)
ANF_receptor 53..432 CDD:279440 38/183 (21%)
PKc_like 555..821 CDD:304357
HNOBA <840..883 CDD:285003
CYCc 862..1051 CDD:214485
Guanylate_cyc 889..1077 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.