DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and phlp-2

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001337270.1 Gene:phlp-2 / 185690 WormBaseID:WBGene00009647 Length:1126 Species:Caenorhabditis elegans


Alignment Length:247 Identity:46/247 - (18%)
Similarity:76/247 - (30%) Gaps:94/247 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RALVLLPDDNMYQA--SLPRVLPILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDG 105
            |||.|..||..|..  ..|.:|.......||:...    :|:|        ..|..|.:|.  :.
 Worm   196 RALRLKDDDVCYLIIFQRPNILEAWLTRAQQVEKS----NHVD--------ASDEQLTLIP--EQ 246

  Fly   106 IIKQCAQV----------IFGPVCDYSLAAVSRITKYFNSQGTPLISVG---------------- 144
            |:...|:|          |..|..:.|:|.:..|...:......:|.:.                
 Worm   247 ILNNEARVQILNLRRNSLISRPPTEKSMAPLGYIDDLYRVHSLQVIDLSANQILSFPIQLTLLSH 311

  Fly   145 ------GSTYDFEQKKTDCNDE---FYMLLRTGMLSF--ETISELTINVMKRHNWSHSIFYYERD 198
                  .|.| .....::|::.   .|:.|....|..  ::||||                    
 Worm   312 LRQLNLSSNY-ISSVPSECSNMRRLQYLNLSNNQLDTLPDSISEL-------------------- 355

  Fly   199 GQRSVAGMHTCFLMMKSLGKQMRNENMTFAQF-PLEPNLTNRTEEMRREIGN 249
                               :.:::.:::|.|| .:.|.|.:.|.||.|..||
 Worm   356 -------------------QNLQSLDISFNQFSQIPPCLFHLTLEMWRLAGN 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 37/234 (16%)
phlp-2NP_001337270.1 leucine-rich repeat 232..253 CDD:275380 6/30 (20%)
leucine-rich repeat 254..288 CDD:275380 6/33 (18%)
PLN00113 283..>718 CDD:331614 22/146 (15%)
leucine-rich repeat 289..311 CDD:275380 1/21 (5%)
leucine-rich repeat 312..334 CDD:275380 3/22 (14%)
leucine-rich repeat 335..357 CDD:275380 7/60 (12%)
leucine-rich repeat 358..379 CDD:275380 5/20 (25%)
leucine-rich repeat 380..440 CDD:275380 5/9 (56%)
leucine-rich repeat 441..485 CDD:275380
leucine-rich repeat 486..508 CDD:275380
leucine-rich repeat 509..534 CDD:275380
leucine-rich repeat 554..577 CDD:275380
leucine-rich repeat 578..602 CDD:275380
leucine-rich repeat 603..625 CDD:275380
leucine-rich repeat 626..649 CDD:275380
leucine-rich repeat 650..672 CDD:275380
leucine-rich repeat 673..694 CDD:275380
PP2Cc 754..985 CDD:214625
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.