DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and Npr3

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_032754.2 Gene:Npr3 / 18162 MGIID:97373 Length:536 Species:Mus musculus


Alignment Length:185 Identity:49/185 - (26%)
Similarity:88/185 - (47%) Gaps:29/185 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IRALVLLPDDNMYQASLPRVLPILKVAEQQIR----SKSLIPSHIDFEWLAHDTKCDASLGVIKA 102
            |..|||||.|:.|..||.||.|.::.|.:.:.    .:.|:|....|:....|:.|..     :|
Mouse    48 IEVLVLLPRDDSYLFSLARVRPAIEYALRSVEGNGTGRKLLPPGTRFQVAYEDSDCGN-----RA 107

  Fly   103 MDGIIKQCA-------QVIFGPVCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTDCNDE 160
            :..::.:.|       .:|.||||:|:.|.|:|:..:::   .|::|.|.....|:.|.|    |
Mouse   108 LFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWD---LPMLSAGALAAGFQHKDT----E 165

  Fly   161 FYMLLRTGMLSFETISELTINVMKRHNWSHSIFYY-----ERDGQRSVAGMHTCF 210
            :..|.|... ::..:.|:.:.:.:.|:||.:...|     ||:...::.|:|..|
Mouse   166 YSHLTRVAP-AYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVF 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 47/181 (26%)
Npr3NP_032754.2 PBP1_NPR_C_like 49..440 CDD:107381 48/184 (26%)
ANF_receptor 66..419 CDD:279440 39/167 (23%)
TM_EphA1 471..502 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.876977 Normalized mean entropy S7115
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR44755
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.820

Return to query results.
Submit another query.