DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and Npr1

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_032753.5 Gene:Npr1 / 18160 MGIID:97371 Length:1057 Species:Mus musculus


Alignment Length:223 Identity:49/223 - (21%)
Similarity:84/223 - (37%) Gaps:61/223 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IRALVLLP---------------------DDNMYQASLPRVLPILKVAEQQIRSK-SLIPSHIDF 84
            :|||:|||                     .:..|..|..||.|.:::|..::::: .|:|.    
Mouse    11 LRALLLLPPLLLLRSGHASDLTVAVVLPLTNTSYPWSWARVGPAVELALGRVKARPDLLPG---- 71

  Fly    85 EWLAHDT---------KCDASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRITKYFN----SQ 136
             |.....         .|..:...:.|:|...:....|..||.|.||.|.|.|.|.::.    :.
Mouse    72 -WTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTA 135

  Fly   137 GTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNWSHS--IFYYERDG 199
            |.|.:.:|            ..||:.:..|||. |...:.:....:.:|..|.|.  :.|.:|.|
Mouse   136 GAPALGIG------------VKDEYALTTRTGP-SHVKLGDFVTALHRRLGWEHQALVLYADRLG 187

  Fly   200 QRSVAGMHTCFLMMKSLGKQMRNE-NMT 226
            ..     ..||.:::.|..::|.. |:|
Mouse   188 DD-----RPCFFIVEGLYMRVRERLNIT 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 46/219 (21%)
Npr1NP_032753.5 PBP1_NPR_A 32..439 CDD:107380 43/202 (21%)
ANF_receptor 50..410 CDD:279440 41/184 (22%)
PK_GC-A_B 530..803 CDD:270944
TyrKc 543..797 CDD:197581
HNOBA <812..857 CDD:285003
CYCc 836..1025 CDD:214485
Guanylate_cyc 863..1049 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.