DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gcy-32

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_506452.5 Gene:gcy-32 / 179887 WormBaseID:WBGene00001552 Length:684 Species:Caenorhabditis elegans


Alignment Length:87 Identity:17/87 - (19%)
Similarity:36/87 - (41%) Gaps:4/87 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRITK--YFNSQGTPLISVGGSTYDFEQKKTDCNDE 160
            |:...:.|::|:.|:.:|.  .|.:|....|..:  :.|:.......|.....:..:.:.|....
 Worm   142 GLYHIVKGVVKEVAKRVFD--LDITLVVQGRTQRSVHMNNGERVEEHVVFLINNLSEPRRDSEGS 204

  Fly   161 FYMLLRTGMLSFETISELTINV 182
            ...||.:...:|.||.:.|:.:
 Worm   205 EVSLLTSTNANFPTIVDDTLGI 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 17/87 (20%)
gcy-32NP_506452.5 HNOB 3..167 CDD:285002 7/26 (27%)
HNOBA 226..440 CDD:285003 0/1 (0%)
CYCc 419..608 CDD:214485
Guanylate_cyc 452..627 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.