DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gcy-7

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001360539.1 Gene:gcy-7 / 179222 WormBaseID:WBGene00001534 Length:1117 Species:Caenorhabditis elegans


Alignment Length:161 Identity:38/161 - (23%)
Similarity:65/161 - (40%) Gaps:30/161 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRITK 131
            :|..:::.::|: |..:|.:......|..|......:|.|.|....||.||..:....|...::.
 Worm    63 IAVDRLKRENLM-SGWEFNFTIEFDDCVESEAAGMTVDLIEKHNVDVIIGPTMNQPTLAAFIVSN 126

  Fly   132 YFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSF--ETISELTINVMKRHNWSHSIFY 194
            |||   .|:|:.|  ..:..|.     |:|......|:||.  .::......|:||:.||..::.
 Worm   127 YFN---RPIIAWG--LVNAAQL-----DDFERFPNAGILSAGQRSLGVAIRAVLKRYEWSQFVYA 181

  Fly   195 Y--ERDGQRSVAGMHTCFLMMKSLGKQMRNE 223
            |  |.|.::.|.               |||:
 Worm   182 YFTEEDTEKCVT---------------MRND 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 38/161 (24%)
gcy-7NP_001360539.1 PBP1_NPR_GC-like 36..438 CDD:380575 38/161 (24%)
PKc_like 550..822 CDD:389743
CYCc 860..1049 CDD:214485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.