DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gcy-18

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_502449.2 Gene:gcy-18 / 178237 WormBaseID:WBGene00001543 Length:1113 Species:Caenorhabditis elegans


Alignment Length:150 Identity:33/150 - (22%)
Similarity:65/150 - (43%) Gaps:24/150 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IRALVLLPDDNMYQASLPRVLPILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGI 106
            |.|:.::|:|          ..||.::::.:..:.|:...|:||.::.....::..||..|.:..
 Worm    58 IGAVGVMPND----------ARILNISKENLIEEGLVGDDIEFEIVSRQACSESFEGVAVAAELY 112

  Fly   107 IKQCAQVIFGPVCDYSLAAVSRITKYFNSQGTPLI---SVGGSTYDFEQKKTDCNDEFYMLLRTG 168
            .....:...||.|...|.||:::..::|   .|:|   ||..:..|....||        |.|..
 Worm   113 HVHQVRAFIGPYCAAELEAVTKMATFWN---IPIISYSSVPNAVSDRSVYKT--------LARVS 166

  Fly   169 MLSFETISELTINVMKRHNW 188
            ..:..:|:|.|:.::..:.|
 Worm   167 SKNTNSIAEATVALLLHYKW 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 30/145 (21%)
gcy-18NP_502449.2 Periplasmic_Binding_Protein_Type_1 87..448 CDD:299141 25/110 (23%)
ANF_receptor 87..395 CDD:279440 25/110 (23%)
PKc_like 549..846 CDD:304357
HNOBA <857..903 CDD:285003
CYCc 882..1073 CDD:214485
Guanylate_cyc 909..1095 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.