DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14877 and acy-1

DIOPT Version :9

Sequence 1:	NP_650507.1	Gene:	CG14877 / 41929	FlyBaseID:	FBgn0038380	Length:	254	Species:	Drosophila melanogaster
Sequence 2:	NP_497970.1	Gene:	acy-1 / 175622	WormBaseID:	WBGene00000068	Length:	1253	Species:	Caenorhabditis elegans

Alignment Length:	147	Identity:	27/147 - (18%)
Similarity:	48/147 - (32%)	Gaps:	50/147 - (34%)

- Green bases have known domain annotations that are detailed below.

  Fly    65 LKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRI 129
            :|:||:. ||..|:|...:...:..|.:..|||..:
Worm   564 IKLAERN-RSTQLLPKESNSICIMEDNRKSASLQAL----------------------------- 598

  Fly   130 TKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNWSHSIFY 194
                            :|.:|....||.|:.:......|.:|.::::....|.:|... |..:..
Worm   599 ----------------ATNNFNGSNTDTNNTYSERGVAGSVSKKSVAGSESNSIKGSR-SSGLQL 646

  Fly   195 YERDGQ---RSVAGMHT 208
            ..:||.   .||.|:.|
Worm   647 SLQDGNSDLNSVGGLDT 663

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14877	NP_650507.1	Periplasmic_Binding_Protein_Type_1	46..>241	CDD:299141	27/147 (18%)
acy-1	NP_497970.1	MreD	127..>223	CDD:294686
		CYCc	297..469	CDD:214485
		Guanylate_cyc	317..503	CDD:278633
		SDF	<773..982	CDD:294387
		CYCc	1016..1215	CDD:214485
		Guanylate_cyc	1041..1235	CDD:278633
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2114
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900