DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and acy-3

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_497765.4 Gene:acy-3 / 175489 WormBaseID:WBGene00000070 Length:1243 Species:Caenorhabditis elegans


Alignment Length:188 Identity:44/188 - (23%)
Similarity:72/188 - (38%) Gaps:54/188 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLLLVGLVFGPKDCVATC---------REEPARDCEAICDANGRNCT------IRALVLLPDDNM 53
            |.:..|.:.|.:..:|.|         :|..:| .|.:..:||  ||      |.|:..:|..:.
 Worm   229 VSVAYGRLVGFESVLAQCSSIDAARVLKELDSR-IERLAASNG--CTRVASEGITAVCSIPGIDS 290

  Fly    54 YQASLPRVLPILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASL-----------GVIKAMDGII 107
            ..|:        |:....:..::||.|..|      .|..|.|:           ||:    |:.
 Worm   291 QHAT--------KLCRFSMELETLINSFRD------ATGADVSVCIGIDSGPVTAGVV----GVS 337

  Fly   108 KQCAQVIFGPVCDYSLAAVSRITK---YFNSQGTPLISVGGSTYDFEQKKTDCNDEFY 162
            |....|| |.|.|.:|...|..|:   |.:::....:   |||.:||.:|.....:.|
 Worm   338 KWHYDVI-GSVFDNALLMQSNATEPGVYVSNETRRFL---GSTGEFELEKCPIGWKLY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 30/131 (23%)
acy-3NP_497765.4 TctB 26..137 CDD:284693
CYCc 195..378 CDD:214485 40/173 (23%)
Nucleotidyl_cyc_III 221..382 CDD:299850 42/177 (24%)
CYCc 696..873 CDD:214485
Nucleotidyl_cyc_III 711..880 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.