DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gcy-12

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_494995.2 Gene:gcy-12 / 173902 WormBaseID:WBGene00001538 Length:1679 Species:Caenorhabditis elegans


Alignment Length:312 Identity:58/312 - (18%)
Similarity:101/312 - (32%) Gaps:108/312 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVLLLVGLVFGPKDCVATCREE----PARDCEAICDANGRNCTIRALV-LLPDDN-------MYQ 55
            :|.::..|      ||.:|..:    |:.:.|....|......:.:|| .||...       .|.
 Worm    30 IVFVIAAL------CVTSCDADAVPAPSPEAEPSLGAGANPYLLDSLVKRLPKKGDKKEILISYL 88

  Fly    56 ASLPRVLP-----ILKVA----------EQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIK-AMD 104
            |::|.::.     :|.::          :::..||.|       ..:.|....||.:.|:. |:.
 Worm    89 AAVPTLMGEIDQYLLNLSASNSAQNSSKDRESFSKKL-------NQIVHCLTTDAYVSVVSGALV 146

  Fly   105 GIIKQCAQ-----------VIFGPVCDYSLAAVSRITKYF------------------------- 133
            ..|.:..|           .:||..|...    |..|:.|                         
 Worm   147 AAIVEINQDKDLIPAYQLKYVFGNTCGND----SHSTRLFMEHWQAGARVFIGPEKNCKTEAAMA 207

  Fly   134 NSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNW-SHSIFYYER 197
            .||..|:||...:..|..:     :|..|......:.....|.:..:::||::|| ..|:.|..:
 Worm   208 ASQNLPIISYRCNDQDISR-----DDYHYRTFARTVPPAGEIFKAFMSLMKQYNWRKFSVVYDVK 267

  Fly   198 DGQRSVAGMHTCFLMMKSLGKQMRNENMTFAQFPLEPNLTNRTEEMRREIGN 249
            .|                   |::||  .|..........|:.||.:.||.|
 Worm   268 KG-------------------QVKNE--LFETLKRMVETENKFEEHKFEIMN 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 44/255 (17%)
gcy-12NP_494995.2 PBP1_Speract_GC_like 123..545 CDD:107365 41/213 (19%)
ANF_receptor 140..519 CDD:279440 36/189 (19%)
PK_GC-A_B 648..957 CDD:270944
TyrKc 688..951 CDD:197581
HNOBA <967..1012 CDD:285003
CYCc 991..1183 CDD:214485
Guanylate_cyc 1018..1206 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.