DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and Gucy2c

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001120790.1 Gene:Gucy2c / 14917 MGIID:106903 Length:1072 Species:Mus musculus


Alignment Length:245 Identity:53/245 - (21%)
Similarity:97/245 - (39%) Gaps:57/245 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NGRNCTIRALVLLPDDNMYQASLPRVLPI----LKVAEQQIRSKSL-IPSHIDF---EWLAHDT- 91
            |.||.:....||:.|::.|:..:..:...    |.:..:::|...| :..:..|   :.|.|.: 
Mouse    29 NCRNGSYEISVLMMDNSAYKEPMQNLREAVEEGLDIVRKRLREADLNVTVNATFIYSDGLIHKSG 93

  Fly    92 KCDAS----LGVIKAMDGIIKQ-CAQVIFGPVCDYSLAAVSRITKYFNSQ-GTPLISVG--GSTY 148
            .|.:|    |.:::.:....|. ||  :.||.|.|     |....|.::: ..|:||.|  |.:.
Mouse    94 DCRSSTCEGLDLLREITRDHKMGCA--LMGPSCTY-----STFQMYLDTELNYPMISAGSYGLSC 151

  Fly   149 DFEQKKT----DCNDEFYMLL---RTGMLSFETISELTINVMKRHNWSHSIFYYERDGQRSVAGM 206
            |:::..|    ......|.|:   :....||:..|           |:.|..|  ::|...    
Mouse   152 DYKETLTRILPPARKLMYFLVDFWKVNNASFKPFS-----------WNSSYVY--KNGSEP---- 199

  Fly   207 HTCFLMMKSL--GKQMRNENMTFAQFPLEPNLTNRTEEMRREIGNKHASK 254
            ..||..:.:|  |....:|.:.|      .::..|:|:. :||...|..|
Mouse   200 EDCFWYLNALEAGVSYFSEVLNF------KDVLRRSEQF-QEILTGHNRK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 45/220 (20%)
Gucy2cNP_001120790.1 Periplasmic_Binding_Protein_Type_1 35..415 CDD:299141 50/239 (21%)
PKc_like 480..749 CDD:304357
STYKc 502..744 CDD:214568
CYCc 787..978 CDD:214485
Guanylate_cyc 814..1001 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.