DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gc2

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_021333059.1 Gene:gc2 / 140425 ZFINID:ZDB-GENE-011128-8 Length:1120 Species:Danio rerio


Alignment Length:161 Identity:34/161 - (21%)
Similarity:60/161 - (37%) Gaps:36/161 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TIRALVLLP--DDNMYQASLPRVLPILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDAS------L 97
            ||:..|:.|  .|.::..:.|.|...|.||  .|.....:...|.|:::..|..|:.|      |
Zfish    57 TIKVGVVGPWSCDPIFTKAQPGVAARLAVA--HINKDPYLSQGITFDYIILDEDCETSKSFARFL 119

  Fly    98 GVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFY 162
            |......|.|        |||......|.|.:.|.:|.          :.:.:...:.:.:|   
Zfish   120 GYYTRASGFI--------GPVNPGYCEAASLLGKSWNK----------AVFSWSCIEHELDD--- 163

  Fly   163 MLLRTGMLSFETI---SELTINVMKRHNWSH 190
              :|:......|:   |.:.::.|:...|:|
Zfish   164 --VRSHPTFARTMPVPSLVLLSFMRHFRWAH 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 32/156 (21%)
gc2XP_021333059.1 PBP1_sensory_GC_DEF_like 59..440 CDD:107366 32/159 (20%)
PK_GC-2D 551..815 CDD:270945
HNOBA <824..869 CDD:311573
CYCc 848..1040 CDD:214485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.