DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and LOC1280524

DIOPT Version :10

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_061518472.1 Gene:LOC1280524 / 1280524 VectorBaseID:AGAMI1_000821 Length:1259 Species:Anopheles gambiae


Alignment Length:207 Identity:38/207 - (18%)
Similarity:54/207 - (26%) Gaps:91/207 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KSIKELPLSFKNETGL-----------IFGLLTTAC------GI------------------IGT 289
            :.||:.||:..::..:           ||.:.|..|      |:                  |.|
Mosquito   370 REIKDCPLTDMDKQNIQNKVEEVSKHQIFRIYTAFCWNYTEKGVFHLFDNNEHKPCVCPNCNIST 434

  Fly   290 LLGNLLAQCFLYGWLGAWSKTKRAHLVAAGCGALISTPCLVVVFVFGHSSELL------------ 342
            .|     :|....||          ...:.||.......|.:|..|.....:|            
Mosquito   435 CL-----ECLKSNWL----------YKCSFCGEAFFEVGLGIVREFNEDVNILELVGLYKRNCVD 484

  Fly   343 ---TWIMVGVSITGLCFNWS-----LNVEVF-----------------NQIVAPERRSTAFSYVT 382
               .|.....|..|.|.:.|     |.:.||                 |.|...:..|..|:|..
Mosquito   485 FLEEWWRCEPSHLGFCLSCSSYSEELEICVFCEFLDKHKALKTKPKIENSIQMRQNLSLEFNYSG 549

  Fly   383 L----ISHLCGD 390
            |    |...|.|
Mosquito   550 LNDFPIRWQCSD 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_type1 45..>251 CDD:471960
LOC1280524XP_061518472.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.