DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and Npr2

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_446290.1 Gene:Npr2 / 116564 RGDID:620851 Length:1047 Species:Rattus norvegicus


Alignment Length:313 Identity:63/313 - (20%)
Similarity:109/313 - (34%) Gaps:99/313 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLVLLLVGLVFGPKDCVATCREEPARDCEAICDANGRNCTIRALVLLPDDNM-YQASLPRVLPI 64
            :|:|..|.|.|..|                     ..||.|:  .|:||:.|: |..:.|||.|.
  Rat     7 LLVVAALAGGVRPP---------------------GARNLTL--AVVLPEHNLSYAWAWPRVGPA 48

  Fly    65 LKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRI 129
            :.:|.:.:  ...:|..:.|.....|..|...|..::|:|..:.....::.||.|.|..|:|:|.
  Rat    49 VALAVEAL--GRALPVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYPAASVARF 111

  Fly   130 TKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNWS----- 189
            ..:::   .||::.|.....|..|    |:.:..|:|||. |...:.|..:.:....||:     
  Rat   112 ASHWH---LPLLTAGAVASGFAAK----NEHYRTLVRTGP-SAPKLGEFVVTLHGHFNWTARAAL 168

  Fly   190 -------------------------------HSIFYYERDGQRSVAG--------MHTC--FLMM 213
                                           |.::..|..|......        ::.|  ..|:
  Rat   169 LYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYTREPGGPEQATHFIRANGRIVYICGPLEML 233

  Fly   214 KSLGKQMRNENMT---FAQFPLE----------------PNLTNRTEEMRREI 247
            ..:..|.:.||:|   :..|.|:                |...|||:|..:.:
  Rat   234 HEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTQEQAQAL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 52/260 (20%)
Npr2NP_446290.1 PBP1_NPR_B 26..421 CDD:380607 55/273 (20%)
PK_GC-A_B 518..792 CDD:270944
HNOBA <798..846 CDD:400168
CYCc 825..1009 CDD:214485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.