DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and Adcy6

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_006520366.3 Gene:Adcy6 / 11512 MGIID:87917 Length:1254 Species:Mus musculus


Alignment Length:161 Identity:31/161 - (19%)
Similarity:53/161 - (32%) Gaps:62/161 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVLLLVG----------LVFGPKDCVATCREEPARDCEAICDANGRNCTIRALVLLPDDNMYQAS 57
            |||||:|          |:.|.....::.......||.|:    ||       |.|      :..
Mouse   936 LVLLLLGPPAAIFDNYDLLLGVHGLASSNETFDGLDCPAV----GR-------VAL------KYM 983

  Fly    58 LPRVLPILKVA----EQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKA-----MDGIIK----- 108
            .|.:|.:..:|    .||:.|    .:.:||.|....|.....:..::|     :..|:.     
Mouse   984 TPVILLVFALALYLHAQQVES----TARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAA 1044

  Fly   109 -----------------QCAQVIFGPVCDYS 122
                             :|..|:|..:.::|
Mouse  1045 HFLARERRNDELYYQSCECVAVMFASIANFS 1075

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 18/108 (17%)
Adcy6XP_006520366.3 AC_N 83..454 CDD:318454
Guanylate_cyc 456..640 CDD:306677
DUF1053 668..754 CDD:368844
Guanylate_cyc 1056..1250 CDD:306677 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.