DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and ADCY9

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_005255136.1 Gene:ADCY9 / 115 HGNCID:240 Length:1372 Species:Homo sapiens


Alignment Length:167 Identity:36/167 - (21%)
Similarity:60/167 - (35%) Gaps:41/167 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 FEWLAHDTKCD--ASLGVIKAMDGIIKQCAQVIFG---PVCDYS-------LAAVSRITKYFNSQ 136
            |:.|..:|||:  ::||          .|...:.|   |..|::       |..:..|.::...:
Human   426 FDRLCEETKCEKISTLG----------DCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK 480

  Fly   137 ------------GTPLISV-GGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNW 188
                        ||.|..: |...:.|:....|.| ...::.:.|:.....|||.|...:.....
Human   481 KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVN-LANLMEQLGVAGKVHISEATAKYLDDRYE 544

  Fly   189 SHSIFYYERDGQRSVA----GMHTCFLMMKSLGKQMR 221
            .......||.||..||    |:.| :|:.....|:.|
Human   545 MEDGKVIERLGQSVVADQLKGLKT-YLISGQRAKESR 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 36/167 (22%)
ADCY9XP_005255136.1 DUF2339 <118..>301 CDD:287113
CYCc 326..544 CDD:214485 25/128 (20%)
Guanylate_cyc 385..573 CDD:278633 34/158 (22%)
CYCc 1043..1243 CDD:214485
Guanylate_cyc 1069..1260 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.