DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and ADCY3

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_011530791.1 Gene:ADCY3 / 109 HGNCID:234 Length:1186 Species:Homo sapiens


Alignment Length:214 Identity:35/214 - (16%)
Similarity:77/214 - (35%) Gaps:61/214 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRI----TKYFNSQG- 137
            :|:..||  ...::..:..:..::.::.||.....::..|    ....:::|    :.|..:.| 
Human   971 LPNFADF--YTEESINNGGIECLRFLNEIISDFDSLLDNP----KFRVITKIKTIGSTYMAASGV 1029

  Fly   138 TPLISVGGSTYDFEQKK-----------------------TDCNDEFY--MLLRTGMLSFETISE 177
            ||.::..|.....::.|                       |:.|::.:  .:||.||.....::.
Human  1030 TPDVNTNGFASSNKEDKSERERWQHLADLADFALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAG 1094

  Fly   178 LTINVMKRHN--WSHSIFYYERDGQRSVAG----MHTCFLMMKSLGKQM----------RNENMT 226
            : |...|.|.  |.:::....|.....|.|    :....::::..|.:.          :.|.:|
Human  1095 V-IGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLT 1158

  Fly   227 F--------AQFPLEPNLT 237
            |        |.||..|::|
Human  1159 FFLKGRDKLATFPNGPSVT 1177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 35/214 (16%)
ADCY3XP_011530791.1 AC_N <44..303 CDD:292831
CYCc 273..490 CDD:214485
Guanylate_cyc 310..516 CDD:278633
CYCc 925..1143 CDD:214485 27/178 (15%)
Guanylate_cyc 956..1163 CDD:278633 30/198 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.