DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and ADCY2

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_065433.2 Gene:ADCY2 / 108 HGNCID:233 Length:1091 Species:Homo sapiens


Alignment Length:148 Identity:26/148 - (17%)
Similarity:53/148 - (35%) Gaps:44/148 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQ---CAQVIFGPVCDYS-------------- 122
            ::::|:|:...:||...|          .:.:..|   |..|:|..:.|:.              
Human   857 ENVLPAHVAEHFLARSLK----------NEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLE 911

  Fly   123 -LAAVSRITKYFNS-------QGTPLISVGGSTYDF--------EQKKTDCNDEFYMLLRTGMLS 171
             |..::.|...|:.       .|...|...||||..        .|:.:...:..||.:.| |:.
Human   912 CLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHSQEPERQYMHIGT-MVE 975

  Fly   172 FETISELTINVMKRHNWS 189
            |.......::.:.:|:::
Human   976 FAFALVGKLDAINKHSFN 993

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 26/148 (18%)
ADCY2NP_065433.2 AC_N <33..260 CDD:292831
CYCc 236..439 CDD:214485
Guanylate_cyc 281..465 CDD:278633
DUF1053 495..599 CDD:283888
CYCc 848..1056 CDD:214485 26/148 (18%)
Guanylate_cyc 878..1077 CDD:278633 21/117 (18%)
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 905..922 2/16 (13%)
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 990..993 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.