DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and ADCY1

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_066939.1 Gene:ADCY1 / 107 HGNCID:232 Length:1119 Species:Homo sapiens


Alignment Length:239 Identity:51/239 - (21%)
Similarity:81/239 - (33%) Gaps:73/239 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLVGL-VFGPKDCVATCREEPARDCEAICDANGRNCTIRALVLLPDDN-----MYQASLPRVLP 63
            ||.||: ::|....:.|.|.:.....:|      |:| |...:.|.|:|     :..:.|||.:.
Human   219 LLFVGVNMYGVFVRILTERSQRKAFLQA------RSC-IEDRLRLEDENEKQERLLMSLLPRNVA 276

  Fly    64 I------LKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCA--------QVI 114
            :      ||..| :|..|..|..|.:...|..|         |....|:..||.        ..:
Human   277 MEMKEDFLKPPE-RIFHKIYIQRHDNVSILFAD---------IVGFTGLASQCTAQELVKLLNEL 331

  Fly   115 FGPVCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETI---- 175
            ||   .:...|.....:.....|.....|.|.|    |.||   |..:..:..|:...:||    
Human   332 FG---KFDELATENHCRRIKILGDCYYCVSGLT----QPKT---DHAHCCVEMGLDMIDTITSVA 386

  Fly   176 --SELTINVMKRHNWSHSIFYYERDGQRSVAGMHTCFLMMKSLG 217
              :|:.:|:.                    .|:||..::...||
Human   387 EATEVDLNMR--------------------VGLHTGRVLCGVLG 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 40/197 (20%)
ADCY1NP_066939.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
AC_N <161..292 CDD:292831 21/80 (26%)
CYCc 258..453 CDD:214485 39/193 (20%)
Guanylate_cyc 294..476 CDD:278633 29/156 (19%)
Interaction with calmodulin. /evidence=ECO:0000250 493..520
CYCc 826..1037 CDD:214485
Guanylate_cyc 859..1056 CDD:278633
Interaction with calmodulin. /evidence=ECO:0000250 1024..1047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.