DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and npr3

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_004910476.1 Gene:npr3 / 100495974 XenbaseID:XB-GENE-1012470 Length:508 Species:Xenopus tropicalis


Alignment Length:253 Identity:64/253 - (25%)
Similarity:115/253 - (45%) Gaps:37/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLVLLLVGLVFGPKDCVATCREEPARDCEAICDANGRNCTIRALVLLPDDNMYQASLPRVLPIL 65
            :||:.|:|.||.       ..:..|..:           .|:..|||||.||.|..|:.||.|.:
 Frog     4 ILLLSLMVTLVI-------LAKSNPVDE-----------DTVNMLVLLPKDNSYMFSMDRVRPAV 50

  Fly    66 KVAEQQIR-SKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIK-QCAQVIFGPVCDYSLAAVSR 128
            ..|.:.|: :::|:|. :.|..:.:|:.| .:..:...:|..:: |...||.||||:|:.|.|:|
 Frog    51 DHALRSIQENQTLLPG-MHFNVIYNDSDC-GNQALFSLIDIAMQLQKPDVILGPVCEYAAAPVAR 113

  Fly   129 ITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNWSHSIF 193
            :..::|   .|::|.|.....|.||    ::|:..|.|...: :..:.|:.:.:.:.|.|:.:..
 Frog   114 LASHWN---VPMLSAGALAIGFMQK----SNEYSHLTRVSPV-YSKMGEMFLAMFRYHKWTKAFL 170

  Fly   194 YYERDG-QRSVAGMHTCFLMMKSLGKQMRNENMTFAQFPLEPNLTNRTEEMRREIGNK 250
            .|..|. ||:      ||..::.:....:.|....:....:.......||:...|.||
 Frog   171 LYTDDNLQRN------CFFTLEGVHLAFKEEGYAMSIHNFDETKHVDAEEIVHSIQNK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 50/197 (25%)
npr3XP_004910476.1 PBP1_NPR_C 25..414 CDD:380609 57/214 (27%)
TM_EphA1 443..474 CDD:391457
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR44755
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.