DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and Adcy7

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:NP_445848.1 Gene:Adcy7 / 84420 RGDID:619966 Length:1100 Species:Rattus norvegicus


Alignment Length:264 Identity:80/264 - (30%)
Similarity:137/264 - (51%) Gaps:36/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   893 LLKRMELYANNLEELVEERTQDYHEEKKKCEK----LLYQLLPQSVAAQLI---SGQPVVAETFD 950
            ||.|...|...|:.|.:::.:..|||.:..|.    ||..:||..|||..|   :.:....:::|
  Rat   832 LLSRQIDYYCRLDCLWKKKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKAAEDWYHQSYD 896

  Fly   951 QVTIYFSDI----VGFTAISAESTPMQVVQFLNDLYTCFDSIV--ENFD-VYKVETIGDAYMVVS 1008
            .|.:.|:.:    |.:|........::.::.||::...||.::  ..|. |.|::|||..||..:
  Rat   897 CVCVMFASVPDFKVFYTECDVNKEGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAA 961

  Fly  1009 GLPIRNGNQ---------HAREIARLALALLEAV-----HNFRIHHRPEDRLKLRIGLHTGACVA 1059
            ||.:.:|::         |...:...::||:..:     |:|       :..:||:|::.|..:|
  Rat   962 GLSVPSGHENQDLERKHVHIGVLVEFSMALMSKLDGINRHSF-------NSFRLRVGINHGPVIA 1019

  Fly  1060 GVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEML 1124
            ||:|.:.|:|.::|:|||.||||||.||..||.::|.|...|...| :....||.:.:|||||:.
  Rat  1020 GVIGARKPQYDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLG-YSCECRGLINVKGKGELR 1083

  Fly  1125 TYWL 1128
            ||::
  Rat  1084 TYFV 1087

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 17/48 (35%)
CYCc 917..1108 CDD:214485 64/218 (29%)
Guanylate_cyc 944..1130 CDD:278633 62/206 (30%)
Adcy7NP_445848.1 AC_N <21..251 CDD:318454
Guanylate_cyc 272..422 CDD:306677
DUF1053 487..593 CDD:399378
Guanylate_cyc 891..1087 CDD:306677 62/203 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.