DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and Adcy3

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:NP_570135.2 Gene:Adcy3 / 64508 RGDID:71009 Length:1144 Species:Rattus norvegicus


Alignment Length:285 Identity:88/285 - (30%)
Similarity:157/285 - (55%) Gaps:42/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   900 YANNLEEL----------VEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISG----QPVVAETFD 950
            ::.::|:|          |.::.:..:|.::..|.|:..:||:.||...:..    :.:.::::|
  Rat   856 FSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYD 920

  Fly   951 QVTIYFSDIVGF----TAISAESTPMQVVQFLNDLYTCFDSIVEN--FDVY-KVETIGDAYMVVS 1008
            ::.:.|:.:..|    |..|..:..::.::|||::.:.|||:::|  |.|. |::|||..||..|
  Rat   921 EIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGSTYMAAS 985

  Fly  1009 GL-PIRNGN----------------QHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGA 1056
            |: |..|.|                ||..::|..|||:.:.:.|  |:::..:...||||::.|.
  Rat   986 GVTPDVNTNGFTSSSKEEKSDKERWQHLADLADFALAMKDTLTN--INNQSFNNFMLRIGMNKGG 1048

  Fly  1057 CVAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKG 1121
            .:|||:|.:.|.|.::|:|||.||||||.|....|.:.|.|:..|.|:| |...|||.:.:||||
  Rat  1049 VLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYG-FRFVRRGPIFVKGKG 1112

  Fly  1122 EMLTYWLEGEVPRPNSLISPSKLML 1146
            |:||::|:|. .||.:..:.|.:.|
  Rat  1113 ELLTFFLKGR-DRPAAFPNGSSVTL 1136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 10/47 (21%)
CYCc 917..1108 CDD:214485 68/218 (31%)
Guanylate_cyc 944..1130 CDD:278633 73/209 (35%)
Adcy3NP_570135.2 AC_N <44..303 CDD:318454
Guanylate_cyc 310..494 CDD:306677
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 504..563
Guanylate_cyc 914..1121 CDD:306677 73/209 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.