DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and adcy3a

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:XP_009290286.1 Gene:adcy3a / 571825 ZFINID:ZDB-GENE-111027-6 Length:1119 Species:Danio rerio


Alignment Length:287 Identity:88/287 - (30%)
Similarity:152/287 - (52%) Gaps:46/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   900 YANNLEELVEERTQ-----DYHEEKKKC-------EKLLYQLLPQSVAAQLISG----QPVVAET 948
            ::.::|:|.  ||.     :.||:|:|.       |.|:..:||:.||...:..    :.:.:::
Zfish   831 FSRHVEKLA--RTLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQS 893

  Fly   949 FDQVTIYFSDIVGF----TAISAESTPMQVVQFLNDLYTCFDSIVENFD---VYKVETIGDAYMV 1006
            :|::.:.|:.|..|    |..|..:..::.::|||::.:.|||:::...   :.|::|||..||.
Zfish   894 YDEIGVMFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEPQFRCITKIKTIGSTYMA 958

  Fly  1007 VSGLPIRNGN-----------------QHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHT 1054
            .||:...|..                 ||..::|..|||:...:.|  |:::..:...|||||:.
Zfish   959 ASGVTSDNNTNGYACMKKEEISDRERWQHLADLADFALAMKVTLMN--INYQSFNNFMLRIGLNK 1021

  Fly  1055 GACVAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKG 1119
            ||.:|||:|.:.|.:.::|:|||.||||||.|....|.:.|.....|.::| |...|||.:.:||
Zfish  1022 GAVLAGVIGARKPHFDIWGNTVNVASRMESTGVMGNIQVVEDCYCILKDYG-FRFVRRGPIFVKG 1085

  Fly  1120 KGEMLTYWLEGEVPRPNSLISPSKLML 1146
            |||:|||:|:|. .:..|.|:.|.:.|
Zfish  1086 KGELLTYFLKGR-EKQGSFINGSFVTL 1111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 14/49 (29%)
CYCc 917..1108 CDD:214485 65/225 (29%)
Guanylate_cyc 944..1130 CDD:278633 69/209 (33%)
adcy3aXP_009290286.1 AC_N <37..304 CDD:292831
CYCc 273..468 CDD:214485
Guanylate_cyc 310..492 CDD:278633
CYCc 858..1075 CDD:214485 63/219 (29%)
Guanylate_cyc 889..1096 CDD:278633 69/209 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.