DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and npr3

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:XP_005165413.1 Gene:npr3 / 569395 ZFINID:ZDB-GENE-060531-91 Length:503 Species:Danio rerio


Alignment Length:530 Identity:135/530 - (25%)
Similarity:235/530 - (44%) Gaps:74/530 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VALLP---SVESDNKNDCIM-----------PKVLPVLELAIRHVQRMGFVGGSHFDIQLISRDT 139
            |.::|   |..:||....:|           .:|.|.:|.|.:.::......|..|:::      
Zfish    14 VLMVPGRTSALNDNIEVMVMLPRNNTYLFSYTRVFPAIEYAKKALREADAYAGLRFNVR------ 72

  Fly   140 FCSSKYGPIGFFEIYTQWPE--VNAVFGLPCEYVLAPISRYADVWQVPVLTTGGNAKEFNKKSES 202
            |.:|..|....:.:..:..:  .:.|.|..|||..:.::|.|..|.:||::.|..|..||.|:..
Zfish    73 FENSACGMDALYALVDRQKDERPDLVLGPVCEYAASSVTRVASHWNIPVISAGALATGFNSKTPE 137

  Fly   203 YSTLTRLKGAQVNNLGNVVRAILNSFNWTRTALIYQNENAKVKGNSVCFLCLAAIHDTIEEHSVY 267
            ||.|||:....: .:....:||...|.|....|||.::    |....|:..:..:...:.|   |
Zfish   138 YSHLTRIAPTYL-KMAETFQAIFGHFGWRTAYLIYDDD----KDERNCYFTMEGVFTVLSE---Y 194

  Fly   268 QLGFD----TSTWTKADITRMLKNVAMQSRIVIMCADPQSIRQIMLTAEELNMIDSGEYVFINIE 328
            .:..|    .|...:.|...::.:| ..|.:||||:....:|.:||.|.. ..:.|..::|.|||
Zfish   195 HISTDFAVLNSNEERVDPDGIITSV-YGSEVVIMCSKADIVRDLMLAAHR-RKLTSDSHIFFNIE 257

  Fly   329 LFSRVQYLTSQPWYDKNDTDLNNERAQKAYTAMLTVTPKQPNDNEYTRVSNEIKAIAAEKYNYTF 393
            ||:...| ....|..::..|   :.|:.||:.:.|||..:....|:...|.|:|....:......
Zfish   258 LFNSSSY-GDGSWRRRDKYD---DEARAAYSFLNTVTLLRSTKPEFEDFSIEMKKSLQQSNIPIC 318

  Fly   394 SDNEPISAFVTSFFDGVLLYANALNESIREDPTMLTRPINGTDMVRRMWNRSFTGITGNVTIDAN 458
            .|...::.|:..|.|.:||||.||.|...:.   ||:. ||.::...||||:|.||.|.|::|||
Zfish   319 EDCSAVNMFMEGFHDALLLYAIALREVKSKG---LTKK-NGLEITHSMWNRTFEGIAGQVSLDAN 379

  Fly   459 GDRLSAYSLLDM-NPTTGRFEIVAHFLHNRLEFEA----NKEIHWAGDREEAPPDRPICGYDGAL 518
            |||...:|::.| :|.:|:.|.|.::......|:.    .:|  |...| ..||.:|:....|.|
Zfish   380 GDRNGDFSVVRMTDPESGKHETVMNYFGTNGSFQILPGFKRE--WFSLR-TIPPPKPLDPSSGGL 441

  Fly   519 CPDNSLPGYAILSIVLGTMV-VVMAVCFFFGYRHYIAEAEINSMSWKVSLEDVMFRDAAERGLRG 582
            ...      |:..|::|.:: ..:.:.|:|..::|           ::::|....|:..:.|.  
Zfish   442 GVS------AVTGIIVGGILGTALLLAFYFFRKNY-----------RITIERRTLREECDIGK-- 487

  Fly   583 SFHSLVKQSS 592
              |..:::.|
Zfish   488 --HRQLREDS 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368 117/433 (27%)
ANF_receptor 108..473 CDD:279440 105/371 (28%)
PK_GC-A_B 589..883 CDD:270944 1/4 (25%)
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003
CYCc 917..1108 CDD:214485
Guanylate_cyc 944..1130 CDD:278633
npr3XP_005165413.1 Periplasmic_Binding_Protein_Type_1 29..416 CDD:299141 111/410 (27%)
ANF_receptor 46..389 CDD:279440 104/366 (28%)
TM_EphA1 436..468 CDD:214014 7/37 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.