DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and si:dkey-206f10.1

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:XP_009293230.1 Gene:si:dkey-206f10.1 / 560719 ZFINID:ZDB-GENE-041014-154 Length:1187 Species:Danio rerio


Alignment Length:269 Identity:81/269 - (30%)
Similarity:139/269 - (51%) Gaps:30/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   909 EERTQDYHEEKKKCEKLLYQLLPQSVAAQLI----SGQPVVAETFDQVTIYFSDIVGFT------ 963
            ::..|:..:.::..|.||:.:||..||...:    :.|.:.::::|:|.:.|:.|.||.      
Zfish   889 QQEVQEMRDLREHNECLLHNILPAHVARHFLERNRNDQELYSQSYDEVGVMFASIAGFNDYYEQK 953

  Fly   964 AISAESTPMQVVQFLNDLYTCFDSIVEN---FDVYKVETIGDAYMVVSGLP------IRNGNQHA 1019
            .|..|.  ::.::.||::...||.::|.   .|:.|::|||..||..|||.      :.|...|.
Zfish   954 EIKHEG--VECLKLLNEIIADFDELLEESYFLDIEKIKTIGSCYMAASGLSPDKQSRVVNDWHHL 1016

  Fly  1020 REIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMES 1084
            .|:...|||:.|.:.....|..  :..:||:|:..|..||||:|...|:|.::|.|||.||||:|
Zfish  1017 SELVLFALAMQETLREINKHSM--NNFQLRVGIAHGPVVAGVIGATKPQYDIWGMTVNLASRMDS 1079

  Fly  1085 NGEALKIHISETTKEALDEFGTFVTTRRGFVPMKG----KGEMLTYWL--EGEVPRPNSLISPSK 1143
            .|.:.:|.:.|.|:..|.::| ||...||.:.:||    ||.:.||::  :..:...|.:....|
Zfish  1080 TGVSGRIQVPEATRNILADWG-FVLELRGEIYIKGVSERKGRVRTYFISTKRRLVSSNGIADRGK 1143

  Fly  1144 LMLTRRSSL 1152
            ...|.|::|
Zfish  1144 NGHTGRTTL 1152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 8/28 (29%)
CYCc 917..1108 CDD:214485 65/209 (31%)
Guanylate_cyc 944..1130 CDD:278633 67/206 (33%)
si:dkey-206f10.1XP_009293230.1 AC_N <135..380 CDD:292831
CYCc 343..538 CDD:214485
Guanylate_cyc 382..564 CDD:278633
DUF1053 <611..661 CDD:283888
CYCc 899..1097 CDD:214485 63/201 (31%)
Guanylate_cyc 928..1126 CDD:278633 67/202 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.